Beta Tubulin Antibody(monoclonal, 5E4) orb623835 from Biorbyt

Product Specs
ItemBeta Tubulin Antibody(monoclonal, 5E4)
CompanyBiorbyt
Price Pricing Info Supplier Page
Catalog Numberorb623835
Quantity10 µg, 100 µg
ReactivityHuman, Mouse, Rat
ApplicationsFC, ICC, IF, WB
TargetBeta Tubulin
Conjugate/TagUnconjugated
ConcentrationAdding 0.2 ml of distilled water will yield a concentration of 500 µg/ml
Sensitivity> 5000 cells
StorageStore at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles
Clone5E4
NCBI Gene AliasesCDCBM6, CSCSC1, M40, OK/SW-cl.56, TUBB1, TUBB5
NCBI Full Gene Nametubulin beta class I
IsotypeMouse IgG1
ImmunogenA synthetic peptide corresponding to a sequence at the C-terminus of human Beta Tubulin (383-412aa EQFTAMFRRKAFLHWYTGEGMDEMEFTEAE), identical to the related mouse and rat sequences
FormatLyophilized
ClonalityMonoclonal
HostMouse

Specifications/Features

Application Notes: Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500µg/ml.

Application Dilutions: Western blot, 0.1-0.5µg/ml, Human, Mouse, Rat Immunocytochemistry/Immunofluorescence, 2µg/ml, Human Flow Cytometry, 1-3µg/1x106 cells, Human

Add to Compare List